YAML Metadata Warning:empty or missing yaml metadata in repo card

Check out the documentation for more information.

ESM2 Protein Model

This is the protein component of a jointly trained NT-ESM2 model pair for DNA-protein analysis.

Model Details

  • Model Type: ESM2 for protein sequences
  • Training: Jointly trained with NT DNA model
  • Architecture: Transformer-based language model for proteins

Usage

from transformers import AutoModel, AutoTokenizer

# Load model and tokenizer
model = AutoModel.from_pretrained("vsubasri/joint-nt-esm2-transcript-coding-protein")
tokenizer = AutoTokenizer.from_pretrained("vsubasri/joint-nt-esm2-transcript-coding-protein")

# Example usage
protein_sequence = "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"
inputs = tokenizer(protein_sequence, return_tensors="pt")
outputs = model(**inputs)

Training Details

  • Jointly trained with DNA sequences for cross-modal understanding
  • Large model variant
  • Transcript-specific protein coding sequences

Files

  • config.json: Model configuration
  • model.safetensors: Model weights
  • tokenizer_config.json: Tokenizer configuration
  • vocab.txt: Vocabulary file
  • special_tokens_map.json: Special tokens mapping

Citation

If you use this model, please cite the original ESM2 paper and your joint training work.

Downloads last month
-
Safetensors
Model size
0.1B params
Tensor type
F32
·
Inference Providers NEW
This model isn't deployed by any Inference Provider. 🙋 Ask for provider support